| Description |
This pool is delivered in one pool of 53 peptides derived from a peptide scan through Spike glycoprotein - Receptor binding domain of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2, Lineage B.1.617.2, India, Delta) covering the following mutations: L0452R and T0478K for T cell assays (e.g. ELISPOT). |
| Sequence |
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK
CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS
NNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQ
PTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Source |
Severe Acute Respiratory Syndrome-related coronavirus 2 (Lineage B.1.617.2) Spike glycoprotein - Receptor-binding domain (covering the following mutations: L0452R and T0478K). |
| Gene ID |
S |
| Length |
223 aa |
| Purity |
Crude (Major peak by ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each individual peptide). |
| Solubility |
Dissolve in a minimum amount of pure DMSO (approx. 50 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system. |
| Form |
Lyophilized |
| Storage |
Store at -20°C. |
| Note |
The peptides of this product are supplied as trifluoroacetate salts. |
Please note that we do not provide HPLC and MS reports for each individual peptide within our peptide library products.
